Lineage for d1n33k_ (1n33 K:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1607891Superfamily c.55.4: Translational machinery components [53137] (3 families) (S)
  5. 1607892Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 1607982Protein Ribosomal protein S11 [53141] (2 species)
  7. 1608008Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries)
    Uniprot P80376
  8. 1608034Domain d1n33k_: 1n33 K: [79902]
    Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33r_, d1n33s_, d1n33t_, d1n33v_
    complexed with mg, par, zn

Details for d1n33k_

PDB Entry: 1n33 (more details), 3.35 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d1n33k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n33k_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

SCOPe Domain Coordinates for d1n33k_:

Click to download the PDB-style file with coordinates for d1n33k_.
(The format of our PDB-style files is described here.)

Timeline for d1n33k_: