Lineage for d1n33i_ (1n33 I:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716671Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 716672Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 716673Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 716753Protein Ribosomal protein S9 [54218] (1 species)
  7. 716754Species Thermus thermophilus [TaxId:274] [54219] (29 PDB entries)
  8. 716769Domain d1n33i_: 1n33 I: [79900]
    Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33r_, d1n33s_, d1n33t_, d1n33v_
    complexed with mg, par, psu, zn

Details for d1n33i_

PDB Entry: 1n33 (more details), 3.35 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
PDB Compounds: (I:) 30S ribosomal protein S9

SCOP Domain Sequences for d1n33i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n33i_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOP Domain Coordinates for d1n33i_:

Click to download the PDB-style file with coordinates for d1n33i_.
(The format of our PDB-style files is described here.)

Timeline for d1n33i_: