Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (11 families) |
Family d.14.1.1: Translational machinery components [54212] (4 proteins) |
Protein Ribosomal protein S9 [54218] (1 species) |
Species Thermus thermophilus [TaxId:274] [54219] (14 PDB entries) |
Domain d1n33i_: 1n33 I: [79900] Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33r_, d1n33s_, d1n33t_, d1n33v_ |
PDB Entry: 1n33 (more details), 3.35 Å
SCOP Domain Sequences for d1n33i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n33i_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus} eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr apqyskr
Timeline for d1n33i_: