Lineage for d1n33c2 (1n33 C:107-207)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722852Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 722853Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 722854Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 722855Protein Ribosomal protein S3 C-terminal domain [54823] (1 species)
  7. 722856Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
  8. 722874Domain d1n33c2: 1n33 C:107-207 [79893]
    Other proteins in same PDB: d1n33b_, d1n33c1, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33r_, d1n33s_, d1n33t_, d1n33v_
    complexed with mg, par, psu, zn

Details for d1n33c2

PDB Entry: 1n33 (more details), 3.35 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
PDB Compounds: (C:) 30S ribosomal protein S3

SCOP Domain Sequences for d1n33c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n33c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d1n33c2:

Click to download the PDB-style file with coordinates for d1n33c2.
(The format of our PDB-style files is described here.)

Timeline for d1n33c2: