Lineage for d1n32t_ (1n32 T:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 211240Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 211323Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 211324Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 211325Protein Ribosomal protein S20 [46994] (1 species)
  7. 211326Species Thermus thermophilus [TaxId:274] [46995] (14 PDB entries)
  8. 211328Domain d1n32t_: 1n32 T: [79889]
    Other proteins in same PDB: d1n32b_, d1n32c1, d1n32c2, d1n32d_, d1n32e1, d1n32e2, d1n32f_, d1n32g_, d1n32h_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32p_, d1n32q_, d1n32r_, d1n32s_, d1n32v_
    complexed with mg, par, psu, zn

Details for d1n32t_

PDB Entry: 1n32 (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin

SCOP Domain Sequences for d1n32t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n32t_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d1n32t_:

Click to download the PDB-style file with coordinates for d1n32t_.
(The format of our PDB-style files is described here.)

Timeline for d1n32t_: