Class a: All alpha proteins [46456] (202 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) |
Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
Protein Ribosomal protein S18 [46913] (1 species) |
Species Thermus thermophilus [TaxId:274] [46914] (15 PDB entries) |
Domain d1n32r_: 1n32 R: [79887] Other proteins in same PDB: d1n32b_, d1n32c1, d1n32c2, d1n32d_, d1n32e1, d1n32e2, d1n32f_, d1n32g_, d1n32h_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32p_, d1n32q_, d1n32s_, d1n32t_, d1n32v_ complexed with mg, par, psu, zn |
PDB Entry: 1n32 (more details), 3 Å
SCOP Domain Sequences for d1n32r_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n32r_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus} psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari lgllpfteklvrk
Timeline for d1n32r_: