SCOP 1.67: Domain d1n32r_: 1n32 R:

Lineage for d1n32r_ (1n32 R:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (1 species)

7. Species Thermus thermophilus [TaxId:274] [46914] (15 PDB entries)

8. Domain d1n32r_: 1n32 R: [79887]
   Other proteins in same PDB: d1n32b_, d1n32c1, d1n32c2, d1n32d_, d1n32e1, d1n32e2, d1n32f_, d1n32g_, d1n32h_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32p_, d1n32q_, d1n32s_, d1n32t_, d1n32v_
   complexed with mg, par, psu, zn

Details for d1n32r_

PDB Entry: 1n32, 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin

SCOP Domain Sequences for d1n32r_:

Sequence; same for both SEQRES and ATOM records:

>d1n32r_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

Timeline for d1n32r_:

• d1n32r_ first appeared in SCOP 1.63
  
• d1n32r_ appears in SCOP 1.65
  
• d1n32r_ appears in SCOP 1.69
  
• d1n32r_ appears in the current release, SCOPe 2.08