![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Ribosomal protein S17 [50304] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries) Uniprot P24321 |
![]() | Domain d1n32q_: 1n32 Q: [79886] Other proteins in same PDB: d1n32b_, d1n32c1, d1n32c2, d1n32d_, d1n32e1, d1n32e2, d1n32f_, d1n32g_, d1n32h_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32p_, d1n32r_, d1n32s_, d1n32t_, d1n32v_ complexed with mg, par, zn |
PDB Entry: 1n32 (more details), 3 Å
SCOPe Domain Sequences for d1n32q_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n32q_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]} pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
Timeline for d1n32q_: