Lineage for d1n32o_ (1n32 O:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986937Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 1986938Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 1986984Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
    automatically mapped to Pfam PF00312
  6. 1986985Protein Ribosomal protein S15 [47065] (3 species)
  7. 1986999Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
    Uniprot P80378
  8. 1987010Domain d1n32o_: 1n32 O: [79884]
    Other proteins in same PDB: d1n32b_, d1n32c1, d1n32c2, d1n32d_, d1n32e1, d1n32e2, d1n32f_, d1n32g_, d1n32h_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32p_, d1n32q_, d1n32r_, d1n32s_, d1n32t_, d1n32v_
    complexed with mg, par, zn

Details for d1n32o_

PDB Entry: 1n32 (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d1n32o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n32o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOPe Domain Coordinates for d1n32o_:

Click to download the PDB-style file with coordinates for d1n32o_.
(The format of our PDB-style files is described here.)

Timeline for d1n32o_: