Lineage for d1n32j_ (1n32 J:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725134Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 725135Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 725136Protein Ribosomal protein S10 [55001] (1 species)
  7. 725137Species Thermus thermophilus [TaxId:274] [55002] (36 PDB entries)
  8. 725140Domain d1n32j_: 1n32 J: [79879]
    Other proteins in same PDB: d1n32b_, d1n32c1, d1n32c2, d1n32d_, d1n32e1, d1n32e2, d1n32f_, d1n32g_, d1n32h_, d1n32i_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32p_, d1n32q_, d1n32r_, d1n32s_, d1n32t_, d1n32v_
    complexed with mg, par, psu, zn

Details for d1n32j_

PDB Entry: 1n32 (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
PDB Compounds: (J:) 30S ribosomal protein S10

SCOP Domain Sequences for d1n32j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n32j_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOP Domain Coordinates for d1n32j_:

Click to download the PDB-style file with coordinates for d1n32j_.
(The format of our PDB-style files is described here.)

Timeline for d1n32j_: