| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) ![]() |
| Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
| Protein Ribosomal protein S8 [56049] (4 species) |
| Species Thermus thermophilus [TaxId:274] [56051] (37 PDB entries) |
| Domain d1n32h_: 1n32 H: [79877] Other proteins in same PDB: d1n32b_, d1n32c1, d1n32c2, d1n32d_, d1n32e1, d1n32e2, d1n32f_, d1n32g_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32p_, d1n32q_, d1n32r_, d1n32s_, d1n32t_, d1n32v_ complexed with mg, par, psu, zn |
PDB Entry: 1n32 (more details), 3 Å
SCOP Domain Sequences for d1n32h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n32h_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw
Timeline for d1n32h_: