Lineage for d1n32e1 (1n32 E:74-154)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891698Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1891699Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1891700Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1891745Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)
  7. 1891773Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
    Uniprot P27152 ! Uniprot P80373
  8. 1891782Domain d1n32e1: 1n32 E:74-154 [79873]
    Other proteins in same PDB: d1n32b_, d1n32c1, d1n32c2, d1n32d_, d1n32e2, d1n32f_, d1n32g_, d1n32h_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32p_, d1n32q_, d1n32r_, d1n32s_, d1n32t_, d1n32v_
    complexed with mg, par, zn

Details for d1n32e1

PDB Entry: 1n32 (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d1n32e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n32e1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

SCOPe Domain Coordinates for d1n32e1:

Click to download the PDB-style file with coordinates for d1n32e1.
(The format of our PDB-style files is described here.)

Timeline for d1n32e1: