Lineage for d1n32d_ (1n32 D:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1030835Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 1030836Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 1030837Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 1030838Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 1030869Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries)
  8. 1030880Domain d1n32d_: 1n32 D: [79872]
    Other proteins in same PDB: d1n32b_, d1n32c1, d1n32c2, d1n32e1, d1n32e2, d1n32f_, d1n32g_, d1n32h_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32p_, d1n32q_, d1n32r_, d1n32s_, d1n32t_, d1n32v_
    complexed with mg, par, zn

Details for d1n32d_

PDB Entry: 1n32 (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
PDB Compounds: (D:) 30S ribosomal protein S4

SCOPe Domain Sequences for d1n32d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n32d_ d.66.1.2 (D:) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOPe Domain Coordinates for d1n32d_:

Click to download the PDB-style file with coordinates for d1n32d_.
(The format of our PDB-style files is described here.)

Timeline for d1n32d_: