Lineage for d1n32c2 (1n32 C:107-207)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904893Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 1904894Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
    automatically mapped to Pfam PF00189
  5. 1904895Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 1904896Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 1904922Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
    Uniprot P80372
  8. 1904931Domain d1n32c2: 1n32 C:107-207 [79871]
    Other proteins in same PDB: d1n32b_, d1n32c1, d1n32d_, d1n32e1, d1n32e2, d1n32f_, d1n32g_, d1n32h_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32p_, d1n32q_, d1n32r_, d1n32s_, d1n32t_, d1n32v_
    complexed with mg, par, zn

Details for d1n32c2

PDB Entry: 1n32 (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d1n32c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n32c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOPe Domain Coordinates for d1n32c2:

Click to download the PDB-style file with coordinates for d1n32c2.
(The format of our PDB-style files is described here.)

Timeline for d1n32c2: