SCOPe 2.05: Domain d1n32c2: 1n32 C:107-207

Lineage for d1n32c2 (1n32 C:107-207)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
   alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)
   automatically mapped to Pfam PF00189

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
   Uniprot P80372

8. Domain d1n32c2: 1n32 C:107-207 [79871]
   Other proteins in same PDB: d1n32b_, d1n32c1, d1n32d_, d1n32e1, d1n32e2, d1n32f_, d1n32g_, d1n32h_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32p_, d1n32q_, d1n32r_, d1n32s_, d1n32t_, d1n32v_
   complexed with mg, par, zn

Details for d1n32c2

PDB Entry: 1n32, 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d1n32c2:

Sequence; same for both SEQRES and ATOM records:

>d1n32c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

Timeline for d1n32c2:

• d1n32c2 first appeared in SCOP 1.63
  
• d1n32c2 appears in SCOPe 2.04
  
• d1n32c2 appears in SCOPe 2.06
  
• d1n32c2 appears in the current release, SCOPe 2.08