Lineage for d1n32c2 (1n32 C:107-207)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256856Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 256857Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 256858Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 256859Protein Ribosomal protein S3 C-terminal domain [54823] (1 species)
  7. 256860Species Thermus thermophilus [TaxId:274] [54824] (14 PDB entries)
  8. 256862Domain d1n32c2: 1n32 C:107-207 [79871]
    Other proteins in same PDB: d1n32b_, d1n32c1, d1n32d_, d1n32e1, d1n32e2, d1n32f_, d1n32g_, d1n32h_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32p_, d1n32q_, d1n32r_, d1n32s_, d1n32t_, d1n32v_
    complexed with mg, par, psu, zn

Details for d1n32c2

PDB Entry: 1n32 (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin

SCOP Domain Sequences for d1n32c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n32c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d1n32c2:

Click to download the PDB-style file with coordinates for d1n32c2.
(The format of our PDB-style files is described here.)

Timeline for d1n32c2: