Lineage for d1n1ta1 (1n1t A:413-634)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 664233Family b.29.1.15: Trypanosoma sialidase, C-terminal domain [82038] (1 protein)
  6. 664234Protein Trypanosoma sialidase, C-terminal domain [82039] (2 species)
  7. 664254Species Trypanosoma rangeli [TaxId:5698] [82040] (10 PDB entries)
  8. 664255Domain d1n1ta1: 1n1t A:413-634 [79821]
    Other proteins in same PDB: d1n1ta2
    complexed with dan, so4

Details for d1n1ta1

PDB Entry: 1n1t (more details), 1.6 Å

PDB Description: Trypanosoma rangeli sialidase in complex with DANA at 1.6 A
PDB Compounds: (A:) sialidase

SCOP Domain Sequences for d1n1ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n1ta1 b.29.1.15 (A:413-634) Trypanosoma sialidase, C-terminal domain {Trypanosoma rangeli [TaxId: 5698]}
gcgaavptaglvgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpvar
qgqtrryqfanyrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrply
gaapasptgswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyigg
prskgaptdsrvtvtnvvlynrrlnsseirtlflsqdmigtd

SCOP Domain Coordinates for d1n1ta1:

Click to download the PDB-style file with coordinates for d1n1ta1.
(The format of our PDB-style files is described here.)

Timeline for d1n1ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n1ta2