Lineage for d1n1id2 (1n1i D:52-94)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747704Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 748081Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein)
  6. 748082Protein Merozoite surface protein 1 (MSP-1) [57240] (3 species)
  7. 748094Species Malaria parasite (Plasmodium knowlesi) [TaxId:5850] [82892] (1 PDB entry)
  8. 748102Domain d1n1id2: 1n1i D:52-94 [79812]
    complexed with his, imd

Details for d1n1id2

PDB Entry: 1n1i (more details), 2.4 Å

PDB Description: The structure of MSP-1(19) from Plasmodium knowlesi
PDB Compounds: (D:) Merozoite surface protein-1

SCOP Domain Sequences for d1n1id2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n1id2 g.3.11.4 (D:52-94) Merozoite surface protein 1 (MSP-1) {Malaria parasite (Plasmodium knowlesi) [TaxId: 5850]}
itceennggcapeaectmddkkeveckctkegseplfegvfcs

SCOP Domain Coordinates for d1n1id2:

Click to download the PDB-style file with coordinates for d1n1id2.
(The format of our PDB-style files is described here.)

Timeline for d1n1id2: