Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein) |
Protein Merozoite surface protein 1 (MSP-1) [57240] (5 species) |
Species Malaria parasite (Plasmodium knowlesi) [TaxId:5850] [82892] (1 PDB entry) |
Domain d1n1ic2: 1n1i C:52-97 [79810] Other proteins in same PDB: d1n1ia3, d1n1ib3, d1n1ic3 complexed with his, imd |
PDB Entry: 1n1i (more details), 2.4 Å
SCOPe Domain Sequences for d1n1ic2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n1ic2 g.3.11.4 (C:52-97) Merozoite surface protein 1 (MSP-1) {Malaria parasite (Plasmodium knowlesi) [TaxId: 5850]} itceennggcapeaectmddkkeveckctkegseplfegvfcssss
Timeline for d1n1ic2: