Lineage for d1n1ic2 (1n1i C:52-101)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 268805Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 269314Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 269546Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein)
  6. 269547Protein Merozoite surface protein 1 (MSP-1) [57240] (3 species)
  7. 269554Species Malaria parasite (Plasmodium knowlesi) [TaxId:5850] [82892] (1 PDB entry)
  8. 269560Domain d1n1ic2: 1n1i C:52-101 [79810]

Details for d1n1ic2

PDB Entry: 1n1i (more details), 2.4 Å

PDB Description: The structure of MSP-1(19) from Plasmodium knowlesi

SCOP Domain Sequences for d1n1ic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n1ic2 g.3.11.4 (C:52-101) Merozoite surface protein 1 (MSP-1) {Malaria parasite (Plasmodium knowlesi)}
itceennggcapeaectmddkkeveckctkegseplfegvfcssssgphh

SCOP Domain Coordinates for d1n1ic2:

Click to download the PDB-style file with coordinates for d1n1ic2.
(The format of our PDB-style files is described here.)

Timeline for d1n1ic2: