Lineage for d1n1ib2 (1n1i B:52-100)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 889622Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 890026Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein)
  6. 890027Protein Merozoite surface protein 1 (MSP-1) [57240] (3 species)
  7. 890039Species Malaria parasite (Plasmodium knowlesi) [TaxId:5850] [82892] (1 PDB entry)
  8. 890043Domain d1n1ib2: 1n1i B:52-100 [79808]

Details for d1n1ib2

PDB Entry: 1n1i (more details), 2.4 Å

PDB Description: The structure of MSP-1(19) from Plasmodium knowlesi
PDB Compounds: (B:) Merozoite surface protein-1

SCOP Domain Sequences for d1n1ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n1ib2 g.3.11.4 (B:52-100) Merozoite surface protein 1 (MSP-1) {Malaria parasite (Plasmodium knowlesi) [TaxId: 5850]}
itceennggcapeaectmddkkeveckctkegseplfegvfcssssgph

SCOP Domain Coordinates for d1n1ib2:

Click to download the PDB-style file with coordinates for d1n1ib2.
(The format of our PDB-style files is described here.)

Timeline for d1n1ib2: