Lineage for d1n1ib2 (1n1i B:52-97)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031775Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein)
  6. 3031776Protein Merozoite surface protein 1 (MSP-1) [57240] (5 species)
  7. 3031789Species Malaria parasite (Plasmodium knowlesi) [TaxId:5850] [82892] (1 PDB entry)
  8. 3031793Domain d1n1ib2: 1n1i B:52-97 [79808]
    Other proteins in same PDB: d1n1ia3, d1n1ib3, d1n1ic3
    complexed with his, imd

Details for d1n1ib2

PDB Entry: 1n1i (more details), 2.4 Å

PDB Description: The structure of MSP-1(19) from Plasmodium knowlesi
PDB Compounds: (B:) Merozoite surface protein-1

SCOPe Domain Sequences for d1n1ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n1ib2 g.3.11.4 (B:52-97) Merozoite surface protein 1 (MSP-1) {Malaria parasite (Plasmodium knowlesi) [TaxId: 5850]}
itceennggcapeaectmddkkeveckctkegseplfegvfcssss

SCOPe Domain Coordinates for d1n1ib2:

Click to download the PDB-style file with coordinates for d1n1ib2.
(The format of our PDB-style files is described here.)

Timeline for d1n1ib2: