![]() | Class g: Small proteins [56992] (91 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein) |
![]() | Protein Merozoite surface protein 1 (MSP-1) [57240] (5 species) |
![]() | Species Malaria parasite (Plasmodium knowlesi) [TaxId:5850] [82892] (1 PDB entry) |
![]() | Domain d1n1ib1: 1n1i B:8-51 [79807] complexed with his, imd |
PDB Entry: 1n1i (more details), 2.4 Å
SCOPe Domain Sequences for d1n1ib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n1ib1 g.3.11.4 (B:8-51) Merozoite surface protein 1 (MSP-1) {Malaria parasite (Plasmodium knowlesi) [TaxId: 5850]} ssahkcidtnvpenaacyryldgteewrcllgfkevggkcvpas
Timeline for d1n1ib1: