Class g: Small proteins [56992] (61 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies) disulphide-bound fold; contains beta-hairpin with two adjacent disulphides |
Superfamily g.3.11: EGF/Laminin [57196] (6 families) |
Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein) |
Protein Merozoite surface protein 1 (MSP-1) [57240] (3 species) |
Species Malaria parasite (Plasmodium knowlesi) [TaxId:5850] [82892] (1 PDB entry) |
Domain d1n1ia2: 1n1i A:52-98 [79806] |
PDB Entry: 1n1i (more details), 2.4 Å
SCOP Domain Sequences for d1n1ia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n1ia2 g.3.11.4 (A:52-98) Merozoite surface protein 1 (MSP-1) {Malaria parasite (Plasmodium knowlesi)} itceennggcapeaectmddkkeveckctkegseplfegvfcssssg
Timeline for d1n1ia2: