Lineage for d1n18h_ (1n18 H:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 222938Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
    has additional strand at N-terminus
  5. 222939Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 222952Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 223017Species Human (Homo sapiens) [TaxId:9606] [49333] (11 PDB entries)
  8. 223054Domain d1n18h_: 1n18 H: [79792]

Details for d1n18h_

PDB Entry: 1n18 (more details), 2 Å

PDB Description: Thermostable mutant of Human Superoxide Dismutase, C6A, C111S

SCOP Domain Sequences for d1n18h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n18h_ b.1.8.1 (H:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens)}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

SCOP Domain Coordinates for d1n18h_:

Click to download the PDB-style file with coordinates for d1n18h_.
(The format of our PDB-style files is described here.)

Timeline for d1n18h_: