Lineage for d1n12c_ (1n12 C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377239Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2377244Family b.2.3.2: Pilus subunits [49405] (10 proteins)
  6. 2377410Protein PapE pilus subunit [81990] (1 species)
  7. 2377411Species Escherichia coli [TaxId:562] [81991] (2 PDB entries)
  8. 2377413Domain d1n12c_: 1n12 C: [79780]
    N-terminal-deleted; bound to a peptide corresponding to the n-terminal extension of the papk pilus subunit, chains B and D

Details for d1n12c_

PDB Entry: 1n12 (more details), 1.87 Å

PDB Description: Crystal structure of the PapE (N-terminal-deleted) pilus subunit bound to a peptide corresponding to the N-terminal extension of the PapK pilus subunit (residues 1-11) from uropathogenic E. coli
PDB Compounds: (C:) mature Fimbrial protein PapE

SCOPe Domain Sequences for d1n12c_:

Sequence, based on SEQRES records: (download)

>d1n12c_ b.2.3.2 (C:) PapE pilus subunit {Escherichia coli [TaxId: 562]}
vpactvsnttvdwqdveiqtlsqngnhekeftvnmrcpynlgtmkvtitatntynnailv
qntsntssdgllvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykgnmq
nliagpfsatatlvasys

Sequence, based on observed residues (ATOM records): (download)

>d1n12c_ b.2.3.2 (C:) PapE pilus subunit {Escherichia coli [TaxId: 562]}
vpactvsnttvdwqdveiqtlsqngnhekeftvnmrcpynlgtmkvtitatntynnailv
qntsntdgllvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykgnmqnl
iagpfsatatlvasys

SCOPe Domain Coordinates for d1n12c_:

Click to download the PDB-style file with coordinates for d1n12c_.
(The format of our PDB-style files is described here.)

Timeline for d1n12c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1n12a_