SCOP 1.67: Domain d1n12a_: 1n12 A:

Lineage for d1n12a_ (1n12 A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (5 families)

5. Family b.2.3.2: Pilus subunits [49405] (4 proteins)

6. Protein PapE pilus subunit [81990] (1 species)

7. Species Escherichia coli [TaxId:562] [81991] (2 PDB entries)

8. Domain d1n12a_: 1n12 A: [79779]

Details for d1n12a_

PDB Entry: 1n12, 1.87 Å

PDB Description: Crystal structure of the PapE (N-terminal-deleted) pilus subunit bound to a peptide corresponding to the N-terminal extension of the PapK pilus subunit (residues 1-11) from uropathogenic E. coli

SCOP Domain Sequences for d1n12a_:

Sequence; same for both SEQRES and ATOM records:

>d1n12a_ b.2.3.2 (A:) PapE pilus subunit {Escherichia coli}
vpactvsnttvdwqdveiqtlsqngnhekeftvnmrcpynlgtmkvtitatntynnailv
qntsntssdgllvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykgnmq
nliagpfsatatlvasys

Timeline for d1n12a_:

• d1n12a_ first appeared in SCOP 1.63
  
• d1n12a_ appears in SCOP 1.65
  
• d1n12a_ appears in SCOP 1.69
  
• d1n12a_ appears in the current release, SCOPe 2.08