Class j: Peptides [58231] (116 folds) |
Fold j.97: BRCA2 BRC4 repeat [82985] (1 superfamily) |
Superfamily j.97.1: BRCA2 BRC4 repeat [82986] (1 family) |
Family j.97.1.1: BRCA2 BRC4 repeat [82987] (1 protein) |
Protein BRCA2 BRC4 repeat [82988] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82989] (1 PDB entry) |
Domain d1n0wb_: 1n0w B: [79773] Other proteins in same PDB: d1n0wa_ bound to Rad51 |
PDB Entry: 1n0w (more details), 1.7 Å
SCOP Domain Sequences for d1n0wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n0wb_ j.97.1.1 (B:) BRCA2 BRC4 repeat {Human (Homo sapiens)} ptllgfhtasgkkvkiakesldkvknlfdekeq
Timeline for d1n0wb_: