Lineage for d1n0wb_ (1n0w B:)

  1. Root: SCOP 1.69
  2. 528313Class j: Peptides [58231] (116 folds)
  3. 529742Fold j.97: BRCA2 BRC4 repeat [82985] (1 superfamily)
  4. 529743Superfamily j.97.1: BRCA2 BRC4 repeat [82986] (1 family) (S)
  5. 529744Family j.97.1.1: BRCA2 BRC4 repeat [82987] (1 protein)
  6. 529745Protein BRCA2 BRC4 repeat [82988] (1 species)
  7. 529746Species Human (Homo sapiens) [TaxId:9606] [82989] (1 PDB entry)
  8. 529747Domain d1n0wb_: 1n0w B: [79773]
    Other proteins in same PDB: d1n0wa_
    bound to Rad51

Details for d1n0wb_

PDB Entry: 1n0w (more details), 1.7 Å

PDB Description: crystal structure of a rad51-brca2 brc repeat complex

SCOP Domain Sequences for d1n0wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0wb_ j.97.1.1 (B:) BRCA2 BRC4 repeat {Human (Homo sapiens)}
ptllgfhtasgkkvkiakesldkvknlfdekeq

SCOP Domain Coordinates for d1n0wb_:

Click to download the PDB-style file with coordinates for d1n0wb_.
(The format of our PDB-style files is described here.)

Timeline for d1n0wb_:

529747
d1n0wb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1n0wa_