Lineage for d1n0vd3 (1n0v D:561-725)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253872Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 253873Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) (S)
  5. 253874Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 253875Protein Elongation factor 2 (eEF-2), domain IV [82575] (1 species)
  7. 253876Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (2 PDB entries)
  8. 253879Domain d1n0vd3: 1n0v D:561-725 [79769]
    Other proteins in same PDB: d1n0vc1, d1n0vc2, d1n0vc4, d1n0vc5, d1n0vd1, d1n0vd2, d1n0vd4, d1n0vd5

Details for d1n0vd3

PDB Entry: 1n0v (more details), 2.85 Å

PDB Description: crystal structure of elongation factor 2

SCOP Domain Sequences for d1n0vd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0vd3 d.14.1.1 (D:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae)}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq

SCOP Domain Coordinates for d1n0vd3:

Click to download the PDB-style file with coordinates for d1n0vd3.
(The format of our PDB-style files is described here.)

Timeline for d1n0vd3: