![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) ![]() |
![]() | Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
![]() | Protein Elongation factor 2 (eEF-2) [82677] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (3 PDB entries) |
![]() | Domain d1n0vc5: 1n0v C:726-842 [79766] Other proteins in same PDB: d1n0vc1, d1n0vc2, d1n0vc3, d1n0vd1, d1n0vd2, d1n0vd3 |
PDB Entry: 1n0v (more details), 2.85 Å
SCOP Domain Sequences for d1n0vc5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n0vc5 d.58.11.1 (C:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae)} epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
Timeline for d1n0vc5: