SCOP 1.63: Domain d1n0vc5: 1n0v C:726-842

Lineage for d1n0vc5 (1n0v C:726-842)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.11: EF-G/eEF-2 domains III and V [54980] (1 family)

5. Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)

6. Protein Elongation factor 2 (eEF-2) [82677] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (2 PDB entries)

8. Domain d1n0vc5: 1n0v C:726-842 [79766]
   Other proteins in same PDB: d1n0vc1, d1n0vc2, d1n0vc3, d1n0vd1, d1n0vd2, d1n0vd3

Details for d1n0vc5

PDB Entry: 1n0v, 2.85 Å

PDB Description: crystal structure of elongation factor 2

SCOP Domain Sequences for d1n0vc5:

Sequence; same for both SEQRES and ATOM records:

>d1n0vc5 d.58.11.1 (C:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae)}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

Timeline for d1n0vc5:

• d1n0vc5 is new in SCOP 1.63
  
• d1n0vc5 appears in SCOP 1.65
  
• d1n0vc5 appears in the current release, SCOPe 2.08