Lineage for d1n0vc4 (1n0v C:482-560)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 604341Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) (S)
  5. 604342Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 604343Protein Elongation factor 2 (eEF-2) [82677] (1 species)
  7. 604344Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (3 PDB entries)
  8. 604347Domain d1n0vc4: 1n0v C:482-560 [79765]
    Other proteins in same PDB: d1n0vc1, d1n0vc2, d1n0vc3, d1n0vd1, d1n0vd2, d1n0vd3

Details for d1n0vc4

PDB Entry: 1n0v (more details), 2.85 Å

PDB Description: crystal structure of elongation factor 2

SCOP Domain Sequences for d1n0vc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0vc4 d.58.11.1 (C:482-560) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae)}
kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic
lqdlehdhagvplkisppv

SCOP Domain Coordinates for d1n0vc4:

Click to download the PDB-style file with coordinates for d1n0vc4.
(The format of our PDB-style files is described here.)

Timeline for d1n0vc4: