Lineage for d1n0vc3 (1n0v C:561-725)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1401399Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1401400Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1401401Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1401402Protein Elongation factor 2 (eEF-2), domain IV [82575] (1 species)
  7. 1401403Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (16 PDB entries)
    Uniprot P32324
  8. 1401415Domain d1n0vc3: 1n0v C:561-725 [79764]
    Other proteins in same PDB: d1n0vc1, d1n0vc2, d1n0vc4, d1n0vc5, d1n0vd1, d1n0vd2, d1n0vd4, d1n0vd5

Details for d1n0vc3

PDB Entry: 1n0v (more details), 2.85 Å

PDB Description: crystal structure of elongation factor 2
PDB Compounds: (C:) Elongation factor 2

SCOPe Domain Sequences for d1n0vc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0vc3 d.14.1.1 (C:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq

SCOPe Domain Coordinates for d1n0vc3:

Click to download the PDB-style file with coordinates for d1n0vc3.
(The format of our PDB-style files is described here.)

Timeline for d1n0vc3: