Lineage for d1n0ua5 (1n0u A:726-842)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 604341Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) (S)
  5. 604342Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 604343Protein Elongation factor 2 (eEF-2) [82677] (1 species)
  7. 604344Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (3 PDB entries)
  8. 604346Domain d1n0ua5: 1n0u A:726-842 [79761]
    Other proteins in same PDB: d1n0ua1, d1n0ua2, d1n0ua3
    complexed with so1

Details for d1n0ua5

PDB Entry: 1n0u (more details), 2.12 Å

PDB Description: crystal structure of yeast elongation factor 2 in complex with sordarin
PDB Compounds: (A:)

SCOP Domain Sequences for d1n0ua5:

Sequence, based on SEQRES records: (download)

>d1n0ua5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae)}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

Sequence, based on observed residues (ATOM records): (download)

>d1n0ua5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae)}
epvflveiqcpeqavggiysvlnkkrgqvvseeqtplftvkaylpvnesfgftgelrqat
ggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

SCOP Domain Coordinates for d1n0ua5:

Click to download the PDB-style file with coordinates for d1n0ua5.
(The format of our PDB-style files is described here.)

Timeline for d1n0ua5: