![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (44 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.11: EF-G/eEF-2 domains III and V [54980] (1 family) ![]() |
![]() | Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins) |
![]() | Protein Elongation factor 2 (eEF-2) [82677] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (2 PDB entries) |
![]() | Domain d1n0ua4: 1n0u A:482-560 [79760] Other proteins in same PDB: d1n0ua1, d1n0ua2, d1n0ua3 |
PDB Entry: 1n0u (more details), 2.12 Å
SCOP Domain Sequences for d1n0ua4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n0ua4 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae)} kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic lqdlehdhagvplkisppv
Timeline for d1n0ua4:
![]() Domains from same chain: (mouse over for more information) d1n0ua1, d1n0ua2, d1n0ua3, d1n0ua5 |