Lineage for d1n0ua3 (1n0u A:561-725)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598219Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 598220Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 598221Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 598222Protein Elongation factor 2 (eEF-2), domain IV [82575] (1 species)
  7. 598223Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (3 PDB entries)
  8. 598224Domain d1n0ua3: 1n0u A:561-725 [79759]
    Other proteins in same PDB: d1n0ua1, d1n0ua2, d1n0ua4, d1n0ua5
    complexed with so1

Details for d1n0ua3

PDB Entry: 1n0u (more details), 2.12 Å

PDB Description: crystal structure of yeast elongation factor 2 in complex with sordarin
PDB Compounds: (A:)

SCOP Domain Sequences for d1n0ua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0ua3 d.14.1.1 (A:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae)}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq

SCOP Domain Coordinates for d1n0ua3:

Click to download the PDB-style file with coordinates for d1n0ua3.
(The format of our PDB-style files is described here.)

Timeline for d1n0ua3: