Lineage for d1n0ua2 (1n0u A:3-343)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830141Protein Elongation factor 2 (eEF-2), N-terminal (G) domain [82404] (1 species)
  7. 830142Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82405] (13 PDB entries)
    Uniprot P32324
  8. 830143Domain d1n0ua2: 1n0u A:3-343 [79758]
    Other proteins in same PDB: d1n0ua1, d1n0ua3, d1n0ua4, d1n0ua5
    complexed with so1

Details for d1n0ua2

PDB Entry: 1n0u (more details), 2.12 Å

PDB Description: crystal structure of yeast elongation factor 2 in complex with sordarin
PDB Compounds: (A:) Elongation factor 2

SCOP Domain Sequences for d1n0ua2:

Sequence, based on SEQRES records: (download)

>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtrkd
eqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalrvt
dgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfartv
esvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmd
rlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvllek
leivlkgdekdlegkallkvvmrkflpaadallemivlhlp

Sequence, based on observed residues (ATOM records): (download)

>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislyse
msdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqte
tvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgdv
qvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtnk
dtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkall
kvvmrkflpaadallemivlhlp

SCOP Domain Coordinates for d1n0ua2:

Click to download the PDB-style file with coordinates for d1n0ua2.
(The format of our PDB-style files is described here.)

Timeline for d1n0ua2: