Lineage for d1n0nb1 (1n0n B:1-83)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 437311Fold a.2: Long alpha-hairpin [46556] (14 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 437446Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 437447Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 437559Protein Mn superoxide dismutase (MnSOD) [46618] (6 species)
  7. 437603Species Human (Homo sapiens) [TaxId:9606] [46619] (14 PDB entries)
  8. 437613Domain d1n0nb1: 1n0n B:1-83 [79752]
    Other proteins in same PDB: d1n0na2, d1n0nb2

Details for d1n0nb1

PDB Entry: 1n0n (more details), 1.82 Å

PDB Description: catalytic and structural effects of amino-acid substitution at his30 in human manganese superoxide dismutase

SCOP Domain Sequences for d1n0nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0nb1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
khslpdlpydygalephinaqimqlhhskvhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOP Domain Coordinates for d1n0nb1:

Click to download the PDB-style file with coordinates for d1n0nb1.
(The format of our PDB-style files is described here.)

Timeline for d1n0nb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n0nb2