SCOP 1.67: Domain d1n0ld_: 1n0l D:

Lineage for d1n0ld_ (1n0l D:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (5 families)

5. Family b.2.3.2: Pilus subunits [49405] (4 proteins)

6. Protein PapE pilus subunit [81990] (1 species)

7. Species Escherichia coli [TaxId:562] [81991] (2 PDB entries)

8. Domain d1n0ld_: 1n0l D: [79749]
   Other proteins in same PDB: d1n0la1, d1n0la2, d1n0lc1, d1n0lc2
   N-terminal-deleted
   complexed with mse; mutant

Details for d1n0ld_

PDB Entry: 1n0l, 2.3 Å

PDB Description: Crystal structure of the PapD chaperone (C-terminally 6x histidine-tagged) bound to the PapE pilus subunit (N-terminal-deleted) from uropathogenic E. coli

SCOP Domain Sequences for d1n0ld_:

Sequence, based on SEQRES records:

>d1n0ld_ b.2.3.2 (D:) PapE pilus subunit {Escherichia coli}
vpactvsnttvdwqdveiqtlsqngnhekeftvnmrcpynlgtmkvtitatntynnailv
qntsntssdgllvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykgnmq
nliagpfsatatlvasys

Sequence, based on observed residues (ATOM records):

>d1n0ld_ b.2.3.2 (D:) PapE pilus subunit {Escherichia coli}
vpactvsnttvdwekeftvnmrcpynlgtmkvtitatntynnailvqgllvylynsnagn
igtaitlgtpftpgkitgnnadktislhaklgykpfsatatlvasys

Timeline for d1n0ld_:

• d1n0ld_ first appeared in SCOP 1.63
  
• d1n0ld_ appears in SCOP 1.65
  
• d1n0ld_ appears in SCOP 1.69
  
• d1n0ld_ appears in the current release, SCOPe 2.08