Lineage for d1n0ld_ (1n0l D:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 368237Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 368306Superfamily b.2.3: Bacterial adhesins [49401] (5 families) (S)
  5. 368311Family b.2.3.2: Pilus subunits [49405] (4 proteins)
  6. 368367Protein PapE pilus subunit [81990] (1 species)
  7. 368368Species Escherichia coli [TaxId:562] [81991] (2 PDB entries)
  8. 368372Domain d1n0ld_: 1n0l D: [79749]
    Other proteins in same PDB: d1n0la1, d1n0la2, d1n0lc1, d1n0lc2
    N-terminal-deleted
    complexed with mse; mutant

Details for d1n0ld_

PDB Entry: 1n0l (more details), 2.3 Å

PDB Description: Crystal structure of the PapD chaperone (C-terminally 6x histidine-tagged) bound to the PapE pilus subunit (N-terminal-deleted) from uropathogenic E. coli

SCOP Domain Sequences for d1n0ld_:

Sequence, based on SEQRES records: (download)

>d1n0ld_ b.2.3.2 (D:) PapE pilus subunit {Escherichia coli}
vpactvsnttvdwqdveiqtlsqngnhekeftvnmrcpynlgtmkvtitatntynnailv
qntsntssdgllvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykgnmq
nliagpfsatatlvasys

Sequence, based on observed residues (ATOM records): (download)

>d1n0ld_ b.2.3.2 (D:) PapE pilus subunit {Escherichia coli}
vpactvsnttvdwekeftvnmrcpynlgtmkvtitatntynnailvqgllvylynsnagn
igtaitlgtpftpgkitgnnadktislhaklgykpfsatatlvasys

SCOP Domain Coordinates for d1n0ld_:

Click to download the PDB-style file with coordinates for d1n0ld_.
(The format of our PDB-style files is described here.)

Timeline for d1n0ld_: