Class b: All beta proteins [48724] (141 folds) |
Fold b.7: C2 domain-like [49561] (4 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) |
Family b.7.2.1: Periplasmic chaperone C-domain [49585] (4 proteins) |
Protein PapD [49586] (1 species) |
Species Escherichia coli [TaxId:562] [49587] (5 PDB entries) |
Domain d1n0lc2: 1n0l C:125-215 [79748] Other proteins in same PDB: d1n0la1, d1n0lb_, d1n0lc1, d1n0ld_ complexed with mse; mutant |
PDB Entry: 1n0l (more details), 2.3 Å
SCOP Domain Sequences for d1n0lc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n0lc2 b.7.2.1 (C:125-215) PapD {Escherichia coli} nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa nyntpylsyindyggrpvlsficngsrcsvk
Timeline for d1n0lc2:
View in 3D Domains from other chains: (mouse over for more information) d1n0la1, d1n0la2, d1n0lb_, d1n0ld_ |