SCOP 1.67: Domain d1n0la2: 1n0l A:125-215

Lineage for d1n0la2 (1n0l A:125-215)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.7: C2 domain-like [49561] (4 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family)

5. Family b.7.2.1: Periplasmic chaperone C-domain [49585] (4 proteins)

6. Protein PapD [49586] (1 species)

7. Species Escherichia coli [TaxId:562] [49587] (5 PDB entries)

8. Domain d1n0la2: 1n0l A:125-215 [79745]
   Other proteins in same PDB: d1n0la1, d1n0lb_, d1n0lc1, d1n0ld_

Details for d1n0la2

PDB Entry: 1n0l, 2.3 Å

PDB Description: Crystal structure of the PapD chaperone (C-terminally 6x histidine-tagged) bound to the PapE pilus subunit (N-terminal-deleted) from uropathogenic E. coli

SCOP Domain Sequences for d1n0la2:

Sequence; same for both SEQRES and ATOM records:

>d1n0la2 b.7.2.1 (A:125-215) PapD {Escherichia coli}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsvk

Timeline for d1n0la2:

• d1n0la2 first appeared in SCOP 1.63
  
• d1n0la2 appears in SCOP 1.65
  
• d1n0la2 appears in SCOP 1.69
  
• d1n0la2 appears in the current release, SCOPe 2.08