SCOP 1.67: Domain d1n0la1: 1n0l A:1-124

Lineage for d1n0la1 (1n0l A:1-124)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (2 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (4 proteins)

6. Protein Pilus chaperone PapD, N-domain [49356] (1 species)
   consists of two domains of this fold; domain 2 has an additional strand at the C-terminus

7. Species Escherichia coli [TaxId:562] [49357] (5 PDB entries)

8. Domain d1n0la1: 1n0l A:1-124 [79744]
   Other proteins in same PDB: d1n0la2, d1n0lb_, d1n0lc2, d1n0ld_

Details for d1n0la1

PDB Entry: 1n0l, 2.3 Å

PDB Description: Crystal structure of the PapD chaperone (C-terminally 6x histidine-tagged) bound to the PapE pilus subunit (N-terminal-deleted) from uropathogenic E. coli

SCOP Domain Sequences for d1n0la1:

Sequence; same for both SEQRES and ATOM records:

>d1n0la1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli}
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
ktrp

Timeline for d1n0la1:

• d1n0la1 first appeared in SCOP 1.63
  
• d1n0la1 appears in SCOP 1.65
  
• d1n0la1 appears in SCOP 1.69
  
• d1n0la1 appears in the current release, SCOPe 2.08