SCOP 1.63: Domain d1n0ha3: 1n0h A:461-687

Lineage for d1n0ha3 (1n0h A:461-687)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families)
   both pyridine (Pyr)- and pyrophosphate (PP)-binding modules have this fold
   conserved core consists of two Pyr and two PP-modules and binds two coenzyme molecules

5. Family c.36.1.1: Pyruvate oxidase and decarboxylase THDP-binding domains [52519] (4 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology

6. Protein Acetohydroxyacid synthase catalytic subunit [69470] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69471] (2 PDB entries)

8. Domain d1n0ha3: 1n0h A:461-687 [79736]
   Other proteins in same PDB: d1n0ha1, d1n0hb1

Details for d1n0ha3

PDB Entry: 1n0h, 2.8 Å

PDB Description: crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl

SCOP Domain Sequences for d1n0ha3:

Sequence; same for both SEQRES and ATOM records:

>d1n0ha3 c.36.1.1 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)}
aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg
glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeq
gmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvl
levevdkkvpvlpmvaggsgldefinfdpeverqqtelrhkrtggkh

Timeline for d1n0ha3:

• d1n0ha3 is new in SCOP 1.63
  
• d1n0ha3 appears in SCOP 1.65
  
• d1n0ha3 appears in the current release, SCOPe 2.08