SCOPe 2.05: Domain d1n0ha2: 1n0h A:83-270

Lineage for d1n0ha2 (1n0h A:83-270)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
   automatically mapped to Pfam PF02776

6. Protein Acetohydroxyacid synthase catalytic subunit [88733] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88734] (6 PDB entries)
   Uniprot P07342 84-687

8. Domain d1n0ha2: 1n0h A:83-270 [79735]
   Other proteins in same PDB: d1n0ha1, d1n0ha3, d1n0hb1, d1n0hb3
   complexed with ayd, cie, dtt, fad, k, mg, tpp

Details for d1n0ha2

PDB Entry: 1n0h, 2.8 Å

PDB Description: crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl

PDB Compounds: (A:) Acetolactate synthase

SCOPe Domain Sequences for d1n0ha2:

Sequence; same for both SEQRES and ATOM records:

>d1n0ha2 c.36.1.5 (A:83-270) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqga
ghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafq
eadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpi
ptkttlps

Timeline for d1n0ha2:

• d1n0ha2 first appeared in SCOP 1.63
  
• d1n0ha2 appears in SCOPe 2.04
  
• d1n0ha2 appears in SCOPe 2.06
  
• d1n0ha2 appears in the current release, SCOPe 2.08