Lineage for d1n08a_ (1n08 A:)
- Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds) 
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
barrel, closed; n=6, S=10; greek-key
Superfamily b.43.5: Riboflavin kinase [82114] (1 family) 
Family b.43.5.1: Riboflavin kinase [82115] (1 protein) Protein Riboflavin kinase [82116] (1 species) Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82117] (4 PDB entries) 
Domain d1n08a_: 1n08 A: [79730]
Details for d1n08a_
PDB Entry: 1n08 (more details), 1.6 Å
PDB Description: Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold
SCOP Domain Sequences for d1n08a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n08a_ b.43.5.1 (A:) Riboflavin kinase {Fission yeast (Schizosaccharomyces pombe)}
rpeivgpekvqspypirfegkvvhgfgrgskelgiptanisedaiqellryrdsgvyfgy
amvqkrvfpmvmsvgwnpyyknklrsaevhlierqgedfyeeimrvivlgyirpelnyag
ldkliedihtdirvalnsmdrpsyssykkdpffk
SCOP Domain Coordinates for d1n08a_:
Click to download the PDB-style file with coordinates for d1n08a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n08a_:
- d1n08a_ is new in SCOP 1.63
- d1n08a_ appears in SCOP 1.65
- d1n08a_ appears in the current release, SCOPe 2.08
View in 3D
