Lineage for d1n07b_ (1n07 B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 375649Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 375882Superfamily b.43.5: Riboflavin kinase-like [82114] (1 family) (S)
  5. 375883Family b.43.5.1: Riboflavin kinase-like [82115] (2 proteins)
  6. 375884Protein Riboflavin kinase [82116] (2 species)
  7. 375885Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82117] (4 PDB entries)
  8. 375892Domain d1n07b_: 1n07 B: [79729]
    complexed with adp, fmn

Details for d1n07b_

PDB Entry: 1n07 (more details), 2.45 Å

PDB Description: Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold

SCOP Domain Sequences for d1n07b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n07b_ b.43.5.1 (B:) Riboflavin kinase {Fission yeast (Schizosaccharomyces pombe)}
krpeivgpekvqspypirfegkvvhgfgrgskelgiptanisedaiqellryrdsgvyfg
yamvqkrvfpmvmsvgwnpyyknklrsaevhlierqgedfyeeimrvivlgyirpelnya
gldkliedihtdirvalnsmdrpsyssykkdpffk

SCOP Domain Coordinates for d1n07b_:

Click to download the PDB-style file with coordinates for d1n07b_.
(The format of our PDB-style files is described here.)

Timeline for d1n07b_: