SCOPe 2.06: Domain d1n07a_: 1n07 A:

Lineage for d1n07a_ (1n07 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.5: Riboflavin kinase-like [82114] (3 families)

5. Family b.43.5.1: ATP-dependent riboflavin kinase-like [82115] (2 proteins)
   automatically mapped to Pfam PF01687

6. Protein Riboflavin kinase [82116] (2 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82117] (4 PDB entries)

8. Domain d1n07a_: 1n07 A: [79728]
   complexed with adp, fmn

Details for d1n07a_

PDB Entry: 1n07, 2.45 Å

PDB Description: Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold

PDB Compounds: (A:) putative riboflavin kinase

SCOPe Domain Sequences for d1n07a_:

Sequence; same for both SEQRES and ATOM records:

>d1n07a_ b.43.5.1 (A:) Riboflavin kinase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
rpeivgpekvqspypirfegkvvhgfgrgskelgiptanisedaiqellryrdsgvyfgy
amvqkrvfpmvmsvgwnpyyknklrsaevhlierqgedfyeeimrvivlgyirpelnyag
ldkliedihtdirvalnsmdrpsyssykkdpffk

Timeline for d1n07a_:

• d1n07a_ first appeared in SCOP 1.63
  
• d1n07a_ appears in SCOPe 2.05
  
• d1n07a_ appears in SCOPe 2.07
  
• d1n07a_ appears in the current release, SCOPe 2.08