Lineage for d1n07a_ (1n07 A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298343Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 298562Superfamily b.43.5: Riboflavin kinase [82114] (1 family) (S)
  5. 298563Family b.43.5.1: Riboflavin kinase [82115] (1 protein)
  6. 298564Protein Riboflavin kinase [82116] (2 species)
  7. 298565Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82117] (4 PDB entries)
  8. 298571Domain d1n07a_: 1n07 A: [79728]

Details for d1n07a_

PDB Entry: 1n07 (more details), 2.45 Å

PDB Description: Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold

SCOP Domain Sequences for d1n07a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n07a_ b.43.5.1 (A:) Riboflavin kinase {Fission yeast (Schizosaccharomyces pombe)}
rpeivgpekvqspypirfegkvvhgfgrgskelgiptanisedaiqellryrdsgvyfgy
amvqkrvfpmvmsvgwnpyyknklrsaevhlierqgedfyeeimrvivlgyirpelnyag
ldkliedihtdirvalnsmdrpsyssykkdpffk

SCOP Domain Coordinates for d1n07a_:

Click to download the PDB-style file with coordinates for d1n07a_.
(The format of our PDB-style files is described here.)

Timeline for d1n07a_: