SCOP 1.67: Domain d1n06b_: 1n06 B:

Lineage for d1n06b_ (1n06 B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.5: Riboflavin kinase-like [82114] (1 family)

5. Family b.43.5.1: Riboflavin kinase-like [82115] (2 proteins)

6. Protein Riboflavin kinase [82116] (2 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82117] (4 PDB entries)

8. Domain d1n06b_: 1n06 B: [79727]
   complexed with adp

Details for d1n06b_

PDB Entry: 1n06, 2 Å

PDB Description: Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold

SCOP Domain Sequences for d1n06b_:

Sequence; same for both SEQRES and ATOM records:

>d1n06b_ b.43.5.1 (B:) Riboflavin kinase {Fission yeast (Schizosaccharomyces pombe)}
krpeivgpekvqspypirfegkvvhgfgrgskelgiptanisedaiqellryrdsgvyfg
yamvqkrvfpmvmsvgwnpyyknklrsaevhlierqgedfyeeimrvivlgyirpelnya
gldkliedihtdirvalnsmdrpsyssykkdpffk

Timeline for d1n06b_:

• d1n06b_ first appeared in SCOP 1.63
  
• d1n06b_ appears in SCOP 1.65
  
• d1n06b_ appears in SCOP 1.69
  
• d1n06b_ appears in the current release, SCOPe 2.08