Lineage for d1n05a_ (1n05 A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 229967Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 230182Superfamily b.43.5: Riboflavin kinase [82114] (1 family) (S)
  5. 230183Family b.43.5.1: Riboflavin kinase [82115] (1 protein)
  6. 230184Protein Riboflavin kinase [82116] (1 species)
  7. 230185Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82117] (4 PDB entries)
  8. 230190Domain d1n05a_: 1n05 A: [79725]

Details for d1n05a_

PDB Entry: 1n05 (more details), 2.1 Å

PDB Description: Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold

SCOP Domain Sequences for d1n05a_:

Sequence, based on SEQRES records: (download)

>d1n05a_ b.43.5.1 (A:) Riboflavin kinase {Fission yeast (Schizosaccharomyces pombe)}
peivgpekvqspypirfegkvvhgfgrgskelgiptanisedaiqellryrdsgvyfgya
mvqkrvfpmvmsvgwnpyyknklrsaevhlierqgedfyeeimrvivlgyirpelnyagl
dkliedihtdirvalnsmdrpsyssykkdpffk

Sequence, based on observed residues (ATOM records): (download)

>d1n05a_ b.43.5.1 (A:) Riboflavin kinase {Fission yeast (Schizosaccharomyces pombe)}
peivgpekvqspypirfegkvvhgfgrgskelgiptanisedaiqellryrdsgvyfgya
mvqkrvfpmvmsvsaevhlierqgedfyeeimrvivlgyirpelnyagldkliedihtdi
rvalnsmdrpsyssykkdpffk

SCOP Domain Coordinates for d1n05a_:

Click to download the PDB-style file with coordinates for d1n05a_.
(The format of our PDB-style files is described here.)

Timeline for d1n05a_: