Lineage for d1my5a_ (1my5 A:)
- Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.18: E set domains [81296] (17 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (5 proteins) Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species) Species Human (Homo sapiens) [TaxId:9606] [49255] (3 PDB entries) 
Domain d1my5a_: 1my5 A: [79673]
Details for d1my5a_
PDB Entry: 1my5 (more details), 1.8 Å
PDB Description: NF-kappaB p65 subunit dimerization domain homodimer
SCOP Domain Sequences for d1my5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1my5a_ b.1.18.1 (A:) p65 subunit of NF-kappa B (NFKB), dimerization domain {Human (Homo sapiens)}
taelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvai
vfrtppyadpslqapvrvsmqlrrpsdrelsepmefqylpdtddrhr
SCOP Domain Coordinates for d1my5a_:
Click to download the PDB-style file with coordinates for d1my5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1my5a_:
- d1my5a_ is new in SCOP 1.63
- d1my5a_ appears in SCOP 1.65
- d1my5a_ appears in the current release, SCOPe 2.08
View in 3D
