| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.43: Mechanosensitive channel protein MscS (YggB), C-terminal domain [82689] (1 family) ![]() the last strand of the fold is flipped away and involved in oligomerisation |
| Family d.58.43.1: Mechanosensitive channel protein MscS (YggB), C-terminal domain [82690] (1 protein) |
| Protein Mechanosensitive channel protein MscS (YggB), C-terminal domain [82691] (1 species) |
| Species Escherichia coli [TaxId:562] [82692] (1 PDB entry) |
| Domain d1mxmg2: 1mxm G:180-280 [79666] Other proteins in same PDB: d1mxma1, d1mxma3, d1mxmb1, d1mxmb3, d1mxmc1, d1mxmc3, d1mxmd1, d1mxmd3, d1mxme1, d1mxme3, d1mxmf1, d1mxmf3, d1mxmg1, d1mxmg3 |
PDB Entry: 1mxm (more details), 3.9 Å
SCOP Domain Sequences for d1mxmg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mxmg2 d.58.43.1 (G:180-280) Mechanosensitive channel protein MscS (YggB), C-terminal domain {Escherichia coli}
repvrrnefiigvaydsdidqvkqiltniiqsedrilkdremtvrlnelgassinfvvrv
wsnsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrv
Timeline for d1mxmg2: